SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0AST3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0AST3
Domain Number 1 Region: 6-286
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.24e-44
Family Haloperoxidase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0AST3
Sequence length 290
Comment (tr|Q0AST3|Q0AST3_MARMM) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:ABI64654.1} KW=Complete proteome; Reference proteome OX=394221 OS=Maricaulis maris (strain MCS10). GN=Mmar10_0361 OC=Hyphomonadaceae; Maricaulis.
Sequence
MTDAHFTDHFFETADGPRIHWRDYPAMGKEAGLPVICLHGLTRNVRDFEDFAPMVAATGR
RVISISSRGRGQSDHDPVVTRYQPPTYAGDVMALLASIGLSRAVFVGTSMGGLMTFIIAS
LQPSLVAAAVINDIGPEIATEGLDRIKSNVSSRDPVTSWADAAARTRQSNLAAFPKRDGD
AAFWDDFARKTWVEREDGSIALAYDGALVDQMEDGGVLPDLWSFWAPFADIPTLVVRGGI
SDLLTPATVAEMKRRKPDLATVEVPDVGHAPFITEPEAWQAVEAFLGRVD
Download sequence
Identical sequences Q0AST3
gi|114568912|ref|YP_755592.1| WP_011642301.1.83773 394221.Mmar10_0361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]