SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q131B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q131B4
Domain Number 1 Region: 25-274
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.33e-31
Family Dienelactone hydrolase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q131B4
Sequence length 275
Comment (tr|Q131B4|Q131B4_RHOPS) Dienelactone hydrolase {ECO:0000313|EMBL:ABE41325.1} KW=Complete proteome; Reference proteome OX=316057 OS=Rhodopseudomonas palustris (strain BisB5). GN=RPD_4106 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MRLPLLLQIGILLAAGHAAVAAPAPERVDIAGADGKLSALLYKPDGDGPFPAVIALHGCG
GLAGKSGPIKRRYADWAEQLLKSGHAVLLPDSYGSRDLGPQCHAKTPRVLARRERLADIL
AARHWLAQQPWTARQRIGLIGWDNGASALLWAVRPQTAPGRGEPDFRSAVAFYPDCRTSS
RLGWSARAPTLVLIGSSDDISSPSACRSMVDGAQGRSALARMVVYPGAYHEFDHIGVTPH
LTSANDPSVPEQGHLGFDPAARSDAEKRVMHWLGR
Download sequence
Identical sequences Q131B4
316057.RPD_4106 2005386945 WP_011504486.1.68018 gi|91978567|ref|YP_571226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]