SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1M6W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1M6W8
Domain Number 1 Region: 14-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.74e-61
Family Haloalkane dehalogenase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1M6W8
Sequence length 298
Comment (tr|Q1M6W8|Q1M6W8_RHIL3) Putative hydrolase {ECO:0000313|EMBL:CAK03011.1} KW=Complete proteome; Reference proteome OX=216596 OS=Rhizobium leguminosarum bv. viciae (strain 3841). GN=pRL110069 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKNGSEELPMVTLVRHRWMTVAGVETFYREAGREDAPVLLLPHGYPCSSYEFRNLMPRLA
DRWRLIAPDFPGAGYSGTPDDFDYSFDGYAAWLKAFVDAMHVDRFVLYLHDFGSPIGARL
AIKDPRRIVALIIQNGDIPYEDALGPKYADIEATWTLPRSEMRKVLAEAISEENFKEEFL
NDLPPALADTIPPDLWKLHWSLITPRRKEIAMDLIAGLKENRAWFPEHRKYLSEYRPPTL
IVWGPNDHYMPEKSARAYLRDLPDAELHLLGGGHWLLETHLDDVVALIREFLGRVHAA
Download sequence
Identical sequences Q1M6W8
gi|116255269|ref|YP_771102.1|NC_008384 216596.pRL110069 gi|116255269|ref|YP_771102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]