SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2JZA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2JZA1
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.62e-61
Family Biotin biosynthesis protein BioH 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2JZA1
Sequence length 269
Comment (tr|Q2JZA1|Q2JZA1_RHIEC) Probable 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase protein {ECO:0000313|EMBL:ABC94085.1} KW=Complete proteome; Reference proteome OX=347834 OS=Rhizobium etli (strain CFN 42 / ATCC 51251). GN=RHE_PF00194 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MAEAQRYTVGDVTLNYRIDGSGEPLVCIHGVGSYLEAWSGVVERLKDSFTILTFDLRGHG
QSSRVKGRYEIDDFVNEALALADKAGFSTFNLAGFSLGGLIAQRLALTHLDRLRKLVLLS
TVAGRTPDERTRVLERLAALRAGTPADHHNASLSRWLTEEFQENNPAVIARLRERDAEND
PDCYAAAYRVLAETDFGGFLDQIRCPTLIATGEEDAGSNPRMARYMHERIPGSTLSILPG
LRHSILIEAPETVANLIHGFLTREETNHG
Download sequence
Identical sequences Q2JZA1
gi|86360925|ref|YP_472812.1| WP_011428502.1.62937 gi|86360925|ref|YP_472812.1|NC_007766 347834.RHE_PF00194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]