SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2UAQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2UAQ4
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.82e-18
Family Hydroxynitrile lyase-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2UAQ4
Sequence length 256
Comment (tr|Q2UAQ4|Q2UAQ4_ASPOR) Uncharacterized protein {ECO:0000313|EMBL:BAE61361.1} KW=Complete proteome; Reference proteome OX=510516 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold). GN=AO090102000287 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSQSTHPPTLLLTPGSWHTPTSLIHLQTALQKAGYPTQTIAHPTNGAEPPTKTLTDDTTN
LRHTLSQLIDQEGKDVVLIAHSYGGLVISNAAEGFGKKDRGKRGLQGGVVLMVYMTAFLV
PRGKSLFGVLGEFRPANMVLEGSYCRATSARESFYHDLSPEMLAEAEAQLTHSCIGAYTE
SVNYEPWRDISCAYIFCEEDRALGLPVQEMLVEMMRESAPFPVLTGRLKASHSPFYSMPG
ETAEVIRGFISEVEGV
Download sequence
Identical sequences Q2UAQ4
XP_001822494.1.101437 5062.CADAORAP00009433 AO090102000287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]