SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3U1V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3U1V7
Domain Number 1 Region: 55-87,138-188,222-297
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.37e-24
Family DPP6 catalytic domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3U1V7
Sequence length 298
Comment (tr|Q3U1V7|Q3U1V7_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE33386.1} OX=10090 OS=Mus musculus (Mouse). GN=Pla2g7 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVPLKLQALFCLLCCLPWVHPFHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNG
SYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNIL
HLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRD
RSASATYFFEDQVAAKVENRSWLFLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEH
GDPKENVLGSAFDMKQLKDAIDETKIVLMGHSFGGATVLQALSEDQRFRCGVALDPWM
Download sequence
Identical sequences Q3U1V7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]