SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4R5A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4R5A6
Domain Number 1 Region: 28-262
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.47e-85
Family Thioesterases 0.000000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4R5A6
Sequence length 263
Comment (tr|Q4R5A6|Q4R5A6_MACFA) Brain cDNA, clone: QtrA-13985, similar to human palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis,neuronal 1, infantile) (PPT1) {ECO:0000313|EMBL:BAE01719.1} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGVGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETTN
Download sequence
Identical sequences Q4R5A6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]