SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5JZH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5JZH0
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.09e-31
Family Serine carboxypeptidase-like 0.000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5JZH0
Sequence length 202
Comment (tr|Q5JZH0|Q5JZH0_HUMAN) Carboxypeptidase {ECO:0000256|RuleBase:RU361156} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CTSA OC=Catarrhini; Hominidae; Homo.
Sequence
QDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNS
LVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNL
YAPCAGGVPSHFRTLLWSRIWATSSLACHSSGCGIRHCCAQGIKCAWTPPAPTQQLLPPT
STTRTCGRPSTSRSSCHNGTCA
Download sequence
Identical sequences Q5JZH0
ENSP00000408533 ENSP00000408533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]