SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5LKV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5LKV2
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.55e-59
Family Biotin biosynthesis protein BioH 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5LKV2
Sequence length 252
Comment (tr|Q5LKV2|Q5LKV2_RUEPO) Hydrolase, alpha/beta fold family {ECO:0000313|EMBL:AAV97411.1} KW=Complete proteome; Reference proteome OX=246200 OS=(Silicibacter pomeroyi). GN=SPOA0277 OC=Rhodobacteraceae; Ruegeria.
Sequence
MPGLPYLRAGSGPALVFVHGYLGGAAQWAQEIERFKDAFDVIAPNLPGFGAAADRPGCAS
IEEMAAAVLGLLDELGIAEFLLVGHSMGGMIAQQMAADRPDAVKRLVLYGTGPLGLMPDR
FEPIDTSRERLLADGVDCTIRRIGATWFRAGAAAAAYPLLVEIGARANPQAAMAGLGAMA
AWDGRAALPRLSMPTLVLWGDCDKSYRWPQIHTLWSNIPDARLSVVPGTSHAVHLEKPGF
FHSILADFLTEP
Download sequence
Identical sequences Q5LKV2
246200.SPOA0277 WP_011242056.1.46818 gi|56709061|ref|YP_165106.1| gi|56709061|ref|YP_165106.1|NC_006569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]