SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6IT76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6IT76
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000204
Family Haloperoxidase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6IT76
Sequence length 98
Comment (tr|Q6IT76|Q6IT76_XANOO) Lipase/esterase {ECO:0000313|EMBL:AAT35584.1} OX=64187 OS=Xanthomonas oryzae pv. oryzae. GN=lipA OC=Xanthomonadaceae; Xanthomonas.
Sequence
PLVTRLASQGYVVVGSDYLGLGKSNYAYHPYLHSASEASATIDAMRAARSVLQHLKTPLS
GKVMLSGYSQGGHTAMATQREIEAHLSKEFQLVASASI
Download sequence
Identical sequences Q6IT76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]