SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q72KF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q72KF4
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.24e-55
Family Carbon-carbon bond hydrolase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q72KF4
Sequence length 257
Comment (tr|Q72KF4|Q72KF4_THET2) Putative hydrolase {ECO:0000313|EMBL:AAS80689.1} KW=Complete proteome OX=262724 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039). GN=TT_C0341 OC=Thermus.
Sequence
MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPP
RAHAEDLLALLDEAKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRA
KVESWLHALKTGGTVLRLRVALPWVFGRGFLEAHPELLAEEGLRGLAAQAPTKTAQERLL
LGFLTLEDLRPRLKALALPALVLYGTEDLLFPKAYASNLAEALRARLEALPAGHAAPIEA
PLAFARAVRAFLEEVYA
Download sequence
Identical sequences Q72KF4
WP_011172791.1.85415 gi|46198649|ref|YP_004316.1| 262724.TTC0341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]