SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q73ZE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q73ZE1
Domain Number 1 Region: 33-217
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.01e-32
Family Cutinase-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q73ZE1
Sequence length 218
Comment (tr|Q73ZE1|Q73ZE1_MYCPA) Uncharacterized protein {ECO:0000313|EMBL:AAS03979.1} KW=Complete proteome; Reference proteome OX=262316 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10). GN=MAP_1662c OC=Mycobacterium; Mycobacterium avium complex (MAC).
Sequence
MTAAVAMTAVAMAAALLLPPGTPGAAAPASAANCTPVQVVFARGRNESSGPGVLGNAFIS
ALRSRVNRTVGVYAVQYPADTEVAQGANDMSRHIQDMVNSCPDTRPVLGGYSLGAAVTDV
VLAAPIGAFGFDSPLPPGVDQHIAAVALFGNGSQWVGPITNFNPTYNDRTIELCHGADPI
CNPADPNTWKQNWPQHLAGAYIDAGMADQAADFVAGKL
Download sequence
Identical sequences Q73ZE1
gi|499076513|ref|YP_007971991.1| 262316.MAP1662c gi|41407760|ref|NP_960596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]