SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7D3T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7D3T6
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-41
Family Prolyl oligopeptidase, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7D3T6
Sequence length 251
Comment (tr|Q7D3T6|Q7D3T6_AGRFC) Putative peptidase {ECO:0000313|EMBL:AAK90517.2} KW=Complete proteome; Reference proteome OX=176299 OS=tumefaciens (strain C58)). GN=Atu5144 OC=Agrobacterium tumefaciens complex.
Sequence
MAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLLGGQEAVEDGSLVRFSS
RLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALDFLKRQPSVDPERIVLYGNSRGAV
ASAMVATKVADLKAIILTGGVYDLRDAYKTSARGLQEAIRNEAGISDEAFLDRSALYHAH
SIRSETLLLHGKYDDRASVDQAERFSEALARSGVPVRFHALDGGHRLPRDQVTPILRDFL
TRVFAPMATIH
Download sequence
Identical sequences H0HEH1 Q7D3T6 Q9WWD0
gi|159186507|ref|NP_396076.2|NC_003064 gi|159186507|ref|NP_396076.2| 176299.Atu5144 NP_396076.2.86381 WP_003517297.1.33939 WP_003517297.1.35372 WP_003517297.1.51814 WP_003517297.1.57042 WP_003517297.1.62720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]