SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q88FD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q88FD3
Domain Number 1 Region: 28-281
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.43e-28
Family Epoxide hydrolase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q88FD3
Sequence length 287
Comment (tr|Q88FD3|Q88FD3_PSEPK) Uncharacterized protein {ECO:0000313|EMBL:AAN69746.1} KW=Complete proteome; Reference proteome OX=160488 OS=KT2440). GN=PP_4165 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTFMDIAELPRDADNGPSFRSGPGAMSQQIFFAHANGFPSATYGKLFAALAPDYQVQHLA
QHAHDPRFPVDENWQSLVDELLHHLAQQDQPVWGVGHSLGGVLHLHAALRCPEYYRGLVM
LDSPVLTRADQWLLRTAKRFGFIDRITPAGRTLGRRETFNDRDSARDYFAGKSLFRHFDP
DCLDAYVEHGLQVVGQGLQLRFDPATEISIYRSIPHTSPAPARQLQVPLAMVRGNRSNVI
RRHHTLAVRGMPKGEYHSVPGGHMFPLERPADTASLIKGLFDRWSQA
Download sequence
Identical sequences Q88FD3
160488.PP_4165 NP_746282.1.35174 gi|26990857|ref|NP_746282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]