SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8KRR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8KRR8
Domain Number 1 Region: 15-287
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.12e-71
Family Carbon-carbon bond hydrolase 0.000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8KRR8
Sequence length 293
Comment (tr|Q8KRR8|Q8KRR8_PSEFL) 2-hydroxymuconic semialdehyde hydrolase {ECO:0000313|EMBL:AAM88232.1} OX=294 OS=Pseudomonas fluorescens. GN=nahN OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTASLKAPPQAAEQAPEPSPELGREILAAGWRTNLLEQGSGFPLLLIHGSGPGVTAWANW
RLVMPQLAQNHRVLAPDMLGFGYSERPADAHYSLDTWVLHALGVLDAQGIAQADLVGNSF
GGAIALALAVRHPERVRRLVLMGSVGVPFELTSGLDAAWGYRPSLANMRALLDLFAFDRG
LVSEDLAELRYQASIRPGFQESFAAMFPAPRQRWIEELCSDERAIRALPHPTLVVHGRED
QIIPLQASLTLAQWIPNAQLHVFDQCGHWTQIEHAERFARLVEDFLAEAAPLS
Download sequence
Identical sequences A0A010SCR0 A0A0M3R7W0 A0A1H4IDX1 Q6XUR7 Q847H1 Q8KRR8
gi|237797161|ref|YP_002887451.1|NC_012674 gi|32469927|ref|NP_863101.1|NC_004999 gi|38638532|ref|NP_943118.1|NC_005244 gi|38638532|ref|NP_943118.1| WP_011117429.1.100015 WP_011117429.1.36576 WP_011117429.1.57360 WP_011117429.1.93692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]