SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9U8F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9U8F2
Domain Number 1 Region: 13-222
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.14e-43
Family Carboxylesterase/thioesterase 1 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9U8F2
Sequence length 227
Comment (tr|Q9U8F2|Q9U8F2_SCHJA) Lysophospholipase {ECO:0000313|EMBL:AAD52700.1} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MANKLLPAAVVASRSKHTATLIFLHGLGDTGHGWSDTLRQYVPNYFKVICPHANSIPVTL
NGGMCMPAWYDIFALSENAKQDEPGIKGASVELGKFVDAKIKAGIPVENIVIGGFSQGGS
VPLYNALTSTLRYGGIVAFNCWLPLHTKFMSSPTLLTIPKDVPIFQCHGLDDCMIPFAMG
KLTHELLKNFQLSKCELKCYPDLSHSSCEQEMEDLRTFLARNIPGTQ
Download sequence
Identical sequences Q9U8F2
6182.Q9U8F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]