SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V6TB72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6TB72
Domain Number 1 Region: 14-244
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.29e-35
Family Carboxylesterase/lipase 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V6TB72
Sequence length 248
Comment (tr|V6TB72|V6TB72_9BACI) Carboxylesterase {ECO:0000313|EMBL:ESU33990.1} KW=Complete proteome OX=977905 OS=Bacillus sp. 17376. GN=G3A_03430 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRKLVPRPFTFKAGKRAVLLLHGFTGNSADVRMMGRFLEGKGYTCHAPVFKGHGVPPEEL
IHTGPEDWWQDALAGYEFLKSEGYEEIAVAGLSLGGILSLKLGYTKPLKGIVPMCAPMHL
KTEELMYRGVLEYAREYKRMEGKPEEQIEAEVKELEQKSMATLKDLQELIKEVRGSIDLI
YTPTFVVQARNDVIIDPDSANIIHDNIESEHKKLKWYEESGHVITLDKERDQLHEDVYEF
LESLNWKE
Download sequence
Identical sequences V6TB72 W4RSG0
WP_023613943.1.12631 WP_023613943.1.43688 WP_023613943.1.86257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]