SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7Q1M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7Q1M1
Domain Number 1 Region: 15-183
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000311
Family Hydroxynitrile lyase-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7Q1M1
Sequence length 264
Comment (tr|W7Q1M1|W7Q1M1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EWH01777.1} KW=Complete proteome; Reference proteome OX=1403540 OS=Halomonas sp. BC04. GN=Q427_12305 OC=Halomonadaceae; Halomonas.
Sequence
MLVLATPTGRGWVDPGAQNTLEYLQRGDVATATIQYSYLPSHLSIIAEGDYGAENARALF
ETVYEHWTTLPETSRPKLYLHGLSLGSLNSDLSFDFYDIIDDPFHGALWSGPPYRSETWQ
AVTRSRELGSPAWLPTFRNGSVVRFMNQYQGLEMPYGEWGDFRIAFLQYGSDPITFFEPW
SFFREPEWMQEPRAPDVSPELRWYPVVTMLQLLADLTIGNAPPGYGHSFSARHYLDAWAE
LIEPEDWTEAELEQLRGRVADSYP
Download sequence
Identical sequences W7Q1M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]