SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X7EL91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X7EL91
Domain Number 1 Region: 15-283
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.13e-53
Family Carbon-carbon bond hydrolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) X7EL91
Sequence length 288
Comment (tr|X7EL91|X7EL91_9RHOB) Magnesium chelatase {ECO:0000313|EMBL:ETX15916.1} KW=Complete proteome; Reference proteome OX=1449350 OS=Roseivivax halodurans JCM 10272. GN=OCH239_12150 OC=Rhodobacteraceae; Roseivivax.
Sequence
MRFPQDLAGWPHAEHSRLIRVKPHRWHVQIMGQGPDLLFLHGAGGATHSWRDVLPLLASQ
YRCIAVDLPGHGMTRIATRFRSSLPFMAEDLGRLIRSEGWQPQGIVAHSAGAAVALRLAS
EGATSPRIVAFNPALEPFRGLAGVLFPMAARMMAMTPFATSFVRMALVSPDRAATLLQGT
GSTIDPEGVALYARLLRDRAHVEGALLMMSQWSLDRLLSDLPGITAPSLFLLGENDRTVP
PESAETAAARIPHARAERLPGLGHLAHEEAPDLAAARIEMFMADALSA
Download sequence
Identical sequences X7EL91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]