SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384540947|ref|YP_005725030.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384540947|ref|YP_005725030.1|
Domain Number 1 Region: 25-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.14e-50
Family Carbon-carbon bond hydrolase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384540947|ref|YP_005725030.1|
Sequence length 277
Comment hypothetical protein SM11_pC1148 [Sinorhizobium meliloti SM11]
Sequence
MQTVTSHTFGEGGASLPRKTTARGTAYFEAGDGETLILIHGVGMRLEAWAPQIEAFAKTH
RVFALDMPGHGASEKIPAGSTVRDYVAWFGCFLEDLSIARASIAGHSMGAIISGGAVATF
SDRITRVAYLNGVYRRDAAAKAAVLARAEAIRKNGVDAEGPLERWFGEDPESQRARELTR
TWLEMVDPEGYAIAYAAFAGGDEIYADCWPSVECPALFLTGSGDPNSTPEMAKQMASVTP
KGWARIVDGHRHMVNLTAPEIVNALMSEWLTSREKPR
Download sequence
Identical sequences F7XF96
gi|384540947|ref|YP_005725030.1|NC_017327 gi|384540947|ref|YP_005725030.1| WP_014531695.1.48083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]