SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007008 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007008
Domain Number 1 Region: 314-370
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000129
Family SAM (sterile alpha motif) domain 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000007008
Domain Number - Region: 41-69
Classification Level Classification E-value
Superfamily WWE domain 0.00157
Family WWE domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007008   Gene: ENSFALG00000006715   Transcript: ENSFALT00000007039
Sequence length 642
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603327.1:621963:629201:-1 gene:ENSFALG00000006715 transcript:ENSFALT00000007039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGKAQDDVVVPTSGGRYDVHLRARRRVAVYWEEEEAEVRRCTWFYKGDKDNKFIPYSESF
SEELEEAYMIAVTLGEWKKKLESPNREVIILHNPKLMVHYHPVASSDDWVSTPTEQGRPR
TVKRGVENIPVEIPSGEPLQIDHLVFVVHGIGPACDIRFRSIVQCVNDFRNVSLSMLQSH
FRKAQEQQQVGRVEFLPVNWHSSLHSTGVDVDLERITLPSINRLRHFINDTILDVFFYNS
STYCQTIVDTVASEMNRLHRLFLQRNPQFRGGVSIAGHSLGSLILFDLLTNQKADPEEDE
RCAQGSRTTSSMGGIEEVKEILKKLELSEYCDVFEKEKMDRQALFLCTEKNLKEMGIPLG
PRMKILHYISSKTEMKDQSSAAPRHSECGAKPGSPSQHGDSSEEVRSCQYRDVGLGQVSA
NYPQLNYKPSIFFAFGSPIGMFLTVRGVKRIDPSYSLPTCKGFFNIFHPFDPVAYRIEPM
IVPELEFEPMLLPHHKGRKRMHLELKEGLTRMSVDLKNNLLGSLRVAWQSFTRAPLPALE
AGSSEAEAEAQAGTEKQPDMKPEEPPAAVKEEPPPINVGRLNGGNRIDYVLQEKPIESFN
EYLFALQGHLCYWESEDTVLLVLKEIYQTQGITLDQPLPGSQ
Download sequence
Identical sequences U3JW54
ENSFALP00000007008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]