SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Ficedula albicollis 76_1.0 > ENSFALP00000008873

Domain assignment for ENSFALP00000008873 from Ficedula albicollis 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFALP00000008873
Domain Number 1	Region: 79-164
Classification Level	Classification	E-value
Superfamily	HMG-box	4.45e-32
Family	HMG-box	0.00000665
Further Details:

Domain Number 2	Region: 3-81
Classification Level	Classification	E-value
Superfamily	HMG-box	2.49e-26
Family	HMG-box	0.00000661
Further Details:

Domain Number 3	Region: 179-214
Classification Level	Classification	E-value
Superfamily	ARM repeat	0.0000863
Family	GUN4-associated domain	0.076
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFALP00000008873 Gene: ENSFALG00000008507 Transcript: ENSFALT00000008911
Sequence length	215
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603207.1:3897798:3903120:1 gene:ENSFALG00000008507 transcript:ENSFALT00000008911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSSKEKGKF EDMAKADKLRYEKEMKNYVPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKVDGGKKVVAKAEK SKKKKEEEEDEDEDEEDEDDEEEEEEEDEDDDDDE
Download sequence
Identical sequences	A0A091MJ92 A0A093Q2D1 A0A218V6E3 H0ZN87 U3K1G9 ENSFALP00000008873 XP_005038087.1.66865 XP_005482538.1.73095 XP_005516354.1.90289 XP_008629672.1.15636 XP_008924391.1.51550 XP_008924391.1.96775 XP_009082892.1.14518 XP_009101109.1.15306 XP_010398592.1.2935 XP_012425221.1.42559 XP_014747815.1.99236 XP_017674064.1.3805 XP_021397638.1.53032 XP_021397639.1.53032 ENSTGUP00000012063 59729.ENSTGUP00000012063 ENSTGUP00000012063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]