SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000013532 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000013532
Domain Number 1 Region: 330-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-93
Family Protein kinases, catalytic subunit 0.00000000984
Further Details:      
 
Domain Number 2 Region: 156-216
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 68-141
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 2-52
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000982
Family PLC-like (P variant) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000013532   Gene: ENSFALG00000012934   Transcript: ENSFALT00000013588
Sequence length 663
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603183.1:13765320:14051413:-1 gene:ENSFALG00000012934 transcript:ENSFALT00000013588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFHDAPIGYDDFVANCTIQFEDLLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPK
DNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQ
CQVCTCVVHKRCHELIITKCAGLKKQETHDEQVGSQRFSVNMPHKFSIHNYKVPTFCDHC
GSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQR
RKKLIAGAETQPPVPGCASSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAT
ATTSTDNQLSKPGENGENGEVKQAQSKRIGLEEFNFIKVLGKGSFGKVMLAELKGKDEVY
AVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDL
MFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMC
KEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDD
LFESILHDDVLYPVWLSKEAVSILKAFMTKNPNKRLGCVASQNGEDAIKQHPFFKEIDWV
LLEQRKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDETIIKQINQEEFKGFSYFGEE
LLP
Download sequence
Identical sequences U3KES8
ENSFALP00000013532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]