SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014460 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014460
Domain Number 1 Region: 141-674,829-1024
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-262
Family Motor proteins 0.00000000197
Further Details:      
 
Domain Number 2 Region: 1733-1922
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000716
Further Details:      
 
Domain Number 3 Region: 1665-1722
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 
Domain Number 4 Region: 18-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000351
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000014460
Domain Number - Region: 1023-1073
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000398
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014460   Gene: ENSFALG00000013855   Transcript: ENSFALT00000014520
Sequence length 2047
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603288.1:1373471:1411541:-1 gene:ENSFALG00000013855 transcript:ENSFALT00000014520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKDADSAVCQAKAAYNLHIYPQLSTESAPCCKVTATKDSTSSDVIKDVINILNLDVSK
HYVLVEVKESGGEEWVLDINDSPVHRVLLWPRRAQDEHPQQDGYYFLLQERNTDGTIKYV
QMQLLSKETDARRLVERGFLPWHQEDFDDLCNLPNLTETTLLENLKCRFLKHRIYTYAGS
ILIAINPFKFLPIYNPKYVKMYENHQLGKLEPHIFAIADVAYHTMLKKHVNQCIVISGES
GSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQ
VNYLENGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVNEEERKEFHLKQPEDY
FYLNQHNLKIEDGEDLRHEFERLKQAMEMVGFLSATKKQIFSILSAILYLGNVTYKKKAT
GRDEGLDVGPPEVLDILSQLLKVKREILVEVLTKRKTVTANDKLILPYSLNEAITARDSM
AKSLYSALFDWIVLRINHALLNKKDMEESVTCLSIGVLDIFGFEDFETNSFEQFCINYAN
EQLQYYFNQHIFKLEQEEYKSEGITWHNIDYTDNVACIHLISKKPTGLFYLLDEESNFPH
ATNQTLLAKFKQQHEENKFFVGTPVMEPAFIIRHFAGKVKYQIKDFREKNMDYMRPDIVA
LLRSSDSAFVRELIGMDPVAVFRWAVLRAAIRAMAVFAQAGRERAQKTAGVVRQGPRVPL
GELQRSNTPVEKAYRRSVLDFSFDCSEDFDINAFQDIISFCENKKDMHEQIIASIKGLPW
QGDDPCELLRSLSQLQHRSHLLKSKGVKQKQIIPKNLLDSKSLKLIMSMTLHDRTTKSLL
HLHKKKKPPSISAQFQASLNKLLETLGRAEPFFIRCIRSNAEKKEMLFDESLVLQQLRYT
GMLETVRIRRSGYSAKYTFQEFIDQFQVLLPKNAKASKEDICAYLNKLKLNENYYQIGKT
KVFMKEAERQILQDTLHKEVIRKIILLQSWLRMVLERRRFLRLRQAAIVLQACWRSRCVR
MALQRNNAAIEIQAAWRRHRQRKRFLQLRRRVCLLQALLRGHLQRNRYQKMLLEKQKAEE
KQREMQEDEAKEDDTSKDEQSKPTTDELPVKQESEPDQAVEGEDQAQNEQAENLSSSEKA
TLLQKHMVEGSEKGTNSREKRESRRQRGLEHNELQNKHVLLPFEEPSVLGHQEQTVSEEA
LETAPEPEKSTAQEDNVLQGSSEGEKSPSEEKTLLDIPPSNEIKESGSVPEQPPESEAED
TAPDRTKTQGNQNNQIKGSQSFTCSERPKDLALNVRNTLSATGSFQGPADCWADKNRQQR
ATRDLDSPTSAIQRYVDDPEKLKYKREKWKGKRQSDAGQNDVLSQSLDGRIRVDKSPQDH
LEKKGSSASLSDLSTLAQTVAMNQQSPDPIEEEKGNKKYPVQKKPSEHFPTSDSAVPVQP
ASQQGDAKSAFKSPLRRLLGKKPDKKIAKESSDVTEEGDGLSLVSCVLFTDTGGTQRVPE
GSSGQPGRPQAGKESSKAKKNRTIKISKISSVSQNWRASMVREIANANELKHLDEFLLNK
INDLRSQKSGVECLFFEATEKFRGNIKTMYSAPNGQIHVGYKDLVENYQLLVTNLARKRE
EKEVKLVLNLFLSLLDEFIRGYTKKEESEQPKQTKAQKKKRKQDRAIEEHNGHVFTNYQV
SIRQSCEHCSSYIWPMEKACLCSVCKLTCHKKCMSKIQSSCTSCGKKGEQDAEPRHFGVC
VSALTSDRNSVPVVMEKLLEYVEMHGLYTEGIYRKSGSANRMKELKQLLQEDPNSVKLEN
YPIHTITGILKQWLRELPDPLMTSAQYNDFLRAVELPEKQEQLHAIYSVLEQLPQANHNT
LERLIFHLVKVALIEDVNRMSPNALAIVFAPCLLRCPDTSDPLTSMKDVSKTTMCVEMLI
KEQIRKYKIKMEEISQLEAAESFAFRRLSLLRQNASKSSQVKGNDSGTSELDSVHEEEDV
SEANNREKEILIDRIQSIKEEKEDITYRLPELDQRGSDEENVDSETSASTESLLEDKPGR
MDTEGQY
Download sequence
Identical sequences U3KHF6
ENSFALP00000014460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]