SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433626198|ref|YP_007259827.1| from Mycobacterium canettii CIPT 140060008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433626198|ref|YP_007259827.1|
Domain Number 1 Region: 61-139
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000543
Family Acetylcholinesterase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|433626198|ref|YP_007259827.1|
Sequence length 194
Comment Putative para-nitrobenzyl esterase (part 2) [Mycobacterium canettii CIPT 140060008]
Sequence
MNPRGNRHDPARHPGGRGSVRGGDRPELTGDIGLRPGEGSARCGLRPRQAGNRPVRCAQV
HEVPTAAILSASSEVFNEVPVRNPGTLAFVPIVDGDLLPDYPVKLAQEGRSHPVPLIIGT
NKHESALFRLMRSPLMPITPRDHVDVHPDCRRTARSASANRGADRLRVLAMAAQSTLIEY
GYRRRLPDAVGVAR
Download sequence
Identical sequences gi|433626198|ref|YP_007259827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]