SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j1qA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j1qA
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 1.1e-85
Family Plant cytotoxins 0.00000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j1qA   PDB: 1j1q   SUPERFAMILY: 1j1qA
Sequence length 261
Comment (A:)
Sequence
INTITFDAGNATINKYATFMESLRNEAKDPSLKCYGIPMLPNTNSTIKYLLVKLQGASLK
TITLMLRRNNLYVMGYSDPYDNKCRYHIFNDIKGTEYSDVENTLCPSSNPRVAKPINYNG
LYPTLEKKAGVTSRNEVQLGIQILSSDIGKISGQGSFTEKIEAKFLLVAIQMVSEAARFK
YIENQVKTNFNRDFSPNDKVLDLEENWGKISTAIHNSKNGALPKPLELKNADGTKWIVLR
VDEIKPDVGLLNYVNGTCQAT
Download sequence
Identical sequences P23339
000074348|e1j1sA1|292.1.1.1|A:1-261 000074350|e1gikA1|292.1.1.1|A:1-261 000074352|e1j1rA1|292.1.1.1|A:1-261 000074354|e1j1qA1|292.1.1.1|A:1-261 d1gika_ d1j1qa_ d1j1ra_ d1j1sa_ 1j1qA 1gik_A 1j1q_A 1j1r_A 1j1s_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]