SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2h3iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2h3iA
Domain Number 1 Region: 20-131
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 6.24e-116
Family Immunodeficiency virus matrix proteins 0.000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2h3iA   PDB: 2h3i
Sequence length 131
Comment (A:)
Sequence
garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
tgnnsqvsqny
Download sequence
Identical sequences 2h3iA 2h3f_A 2h3i_A 2h3q_A 2h3v_A 2h3z_A 000222625|e2lyaA1|612.1.1.4|A:1-131 000990834|e2lybA1|612.1.1.4|A:1-131 001031275|e2h3fA1|612.1.1.4|A:1-131 001034201|e2h3zA1|612.1.1.4|A:1-131 001034359|e2h3iA1|612.1.1.4|A:1-131 001036311|e2h3vA1|612.1.1.4|A:1-131 001038409|e2h3qA1|612.1.1.4|A:1-131 cath|current|2h3iA00/2-132 d2h3fa_ d2h3ia_ d2h3qa_ d2h3va_ d2h3za_ d2lyaa_ d2lyba_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]