SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000455959 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455959
Domain Number 1 Region: 7-115
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.45e-20
Family Acetylcholinesterase-like 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455959   Gene: ENSG00000198848   Transcript: ENST00000563241
Sequence length 131
Comment pep:novel chromosome:GRCh37:16:55836848:55844567:-1 gene:ENSG00000198848 transcript:ENST00000563241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KELIPEATEKYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHREGASEEEIRLSKMV
MKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAV
EKPPQTEHIEL
Download sequence
Identical sequences H3BQV8
ENSP00000455959 ENSP00000455959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]