SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001906951.1.27508 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001906951.1.27508
Domain Number 1 Region: 23-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000363
Family Ankyrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001906951.1.27508
Sequence length 214
Comment hypothetical protein [Podospora anserina S mat+]; AA=GCF_000226545.1; RF=representative genome; TAX=515849; STAX=5145; NAME=Podospora anserina S mat+; AL=Scaffold; RT=Major
Sequence
MAPPKEEESHEGASTAELLIASCRSNNPTLLVSVASQDDEDAAAALLNNTTTVMGNHLYH
EAASRGHYEIIDTLLDQPSFECDPVNRLEGDTPLHTAIRWINSEPPEQREFGNALVEMML
EAGSNPRIKNKGGLTALQLVDPRNEGLRELIRKHEYASLNQGDFVDVGDVKGGGKLVQQQ
QQQGEEESDDDAEFSGSDDEERAEWERRRKEKRK
Download sequence
Identical sequences B2AT99
Pa_1_15150|chrm1_SC4|Putative XP_001906951.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]