SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_1_15150|chrm1_SC4|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_15150|chrm1_SC4|Putative
Domain Number 1 Region: 23-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000363
Family Ankyrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pa_1_15150|chrm1_SC4|Putative
Sequence length 214
Comment protein of unknown function
Sequence
MAPPKEEESHEGASTAELLIASCRSNNPTLLVSVASQDDEDAAAALLNNTTTVMGNHLYH
EAASRGHYEIIDTLLDQPSFECDPVNRLEGDTPLHTAIRWINSEPPEQREFGNALVEMML
EAGSNPRIKNKGGLTALQLVDPRNEGLRELIRKHEYASLNQGDFVDVGDVKGGGKLVQQQ
QQQGEEESDDDAEFSGSDDEERAEWERRRKEKRK
Download sequence
Identical sequences B2AT99
XP_001906951.1.27508 Pa_1_15150|chrm1_SC4|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]