SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_1_18290|chrm1_SC4|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_1_18290|chrm1_SC4|Putative
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000264
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pa_1_18290|chrm1_SC4|Putative
Sequence length 155
Comment protein of unknown function
Sequence
MHISPQEAHHVAVLAGQGECAKLVTAVKALALREHESPADILIACKDDFQQTAAHIAAKS
GQSKSIDTLSDLLDDNEKRAIYFNMANRFSGDRPIHTAMRHGYLDAFKALVNHGADPTLK
NRFGDVVEDYPGDFEPEEVSRIVEEYRTKVDKLRA
Download sequence
Identical sequences B2AU85
Pa_1_18290|chrm1_SC4|Putative XP_001907287.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]