SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_2_4000|chrm2_SC2|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_2_4000|chrm2_SC2|Putative
Domain Number 1 Region: 13-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.06e-34
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pa_2_4000|chrm2_SC2|Putative
Sequence length 282
Comment protein of unknown function
Sequence
MFPDNPSLIQTGPSSPSSSLWSKPPTPLVLIHDGGGTIFSYYCLNELDRPLHGISNPHYD
SGEPFPGGIPEMASLYIEYIKSVVPRGNLIIGGWSLGGLLSLEVASQLAKEEGDGSRLNL
LGIVMIDSVCPLAWRRGGSEGFLKIIRNGAAWGPHTKEETKRKVTRCFSESSRMVGEWEL
PSWEGRKPPPVILLRAKDKVPVPGEVEGTVSRVDVCREDKHLGWDGYRKGLITKVVDIPG
HHFNIFSEMENVDVVTEEIGRACGELEGWHVRRFVSWGEEKR
Download sequence
Identical sequences B2B5A1
XP_001911151.1.27508 Pa_2_4000|chrm2_SC2|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]