SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005196 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005196
Domain Number 1 Region: 400-477
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.58e-19
Family Intermediate filament protein, coiled coil region 0.00055
Further Details:      
 
Domain Number 2 Region: 168-202
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000012
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005196
Domain Number - Region: 213-278
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00035
Family Intermediate filament protein, coiled coil region 0.011
Further Details:      
 
Domain Number - Region: 378-410
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0379
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005196   Gene: ENSPPYG00000004556   Transcript: ENSPPYT00000005399
Sequence length 584
Comment pep:known_by_projection chromosome:PPYG2:12:52419423:52432042:-1 gene:ENSPPYG00000004556 transcript:ENSPPYT00000005399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFSSQSAFSSMSRRVYSTSSSAGSGGGSRAVGSVCYARGRCGGGGYGIHGRGFGSKS
LYNLGGSRSISISLMGRSTSGFCQGGGVGGFGGGRGFGVGSIGAGGFGGGGFGGGGFGGA
GFGTSNFGLGGFGPSCPPGGIQEVTINQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKF
ASFIDKVRFLEQQNQVLQTKWELLQQVNTSSGTNNLEPLLENYIGGLRRQVDLLNAEQMR
QNTEVRSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGE
VNFLKYLFLTELSQMQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELTAQRSKDEAEA
LYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEE
RGEQALQDARQKLQDLEDALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEES
RMSGELQSHVSISVQNSQVSISGGAGGGGSYGSGGYGSGSGGGYGGGKSYRGGGARGGSG
GGYGSGGGGGGGVSYGGSSRSGRGSSRVQIIQTSTNTSHRRILE
Download sequence
Identical sequences H2NHE4
XP_002823333.1.23681 ENSPPYP00000005196 ENSPPYP00000005196 9600.ENSPPYP00000005196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]