SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256821144|ref|YP_003142343.1|NC_013164 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256821144|ref|YP_003142343.1|NC_013164
Domain Number 1 Region: 20-245
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.89e-39
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256821144|ref|YP_003142343.1|NC_013164
Sequence length 250
Comment Thioesterase [Anaerococcus prevotii DSM 20548 plasmid pAPRE01]
Sequence
MSKNFEILSKEINENNIIANLFIFPFAGGGVSAFRKWKDEFEDIKLLVAQYPGRENRFSE
KAISDINILVDNLFEDMKENFNFRKPYYLFGHSMGTKIVYELALRIKNSDYINPRGIIIS
GGRAPLYKEPHPIYHLDDDGFIEGLRRYEGTPKEILDNKDLISIFLPTLRADFVIDEDYQ
DTKFEKLESPILGLMGDKDQEMNLDELIKWQDYTTKEFTYRYIDGKHMFVNTSPESVIEE
IKEFIKVNEN
Download sequence
Identical sequences C7RI32
gi|256821144|ref|YP_003142343.1|NC_013164 gi|256821144|ref|YP_003142343.1| WP_012797114.1.19141 525919.Apre_1761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]