SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2B5A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2B5A1
Domain Number 1 Region: 13-259
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.06e-34
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2B5A1
Sequence length 282
Comment (tr|B2B5A1|B2B5A1_PODAN) Podospora anserina S mat+ genomic DNA chromosome 2, supercontig 2 {ECO:0000313|EMBL:CAP72976.1} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_2_4000 OC=Podospora.
Sequence
MFPDNPSLIQTGPSSPSSSLWSKPPTPLVLIHDGGGTIFSYYCLNELDRPLHGISNPHYD
SGEPFPGGIPEMASLYIEYIKSVVPRGNLIIGGWSLGGLLSLEVASQLAKEEGDGSRLNL
LGIVMIDSVCPLAWRRGGSEGFLKIIRNGAAWGPHTKEETKRKVTRCFSESSRMVGEWEL
PSWEGRKPPPVILLRAKDKVPVPGEVEGTVSRVDVCREDKHLGWDGYRKGLITKVVDIPG
HHFNIFSEMENVDVVTEEIGRACGELEGWHVRRFVSWGEEKR
Download sequence
Identical sequences B2B5A1
Pa_2_4000|chrm2_SC2|Putative XP_001911151.1.27508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]