SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5XR55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E5XR55
Domain Number - Region: 120-261
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000971
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E5XR55
Sequence length 283
Comment (tr|E5XR55|E5XR55_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:EFV13148.1} KW=Complete proteome; Reference proteome OX=679197 OS=Segniliparus rugosus ATCC BAA-974. GN=HMPREF9336_01977 OC=Segniliparus.
Sequence
MNGYHNVRDTLDRSQQPSKDNPKADGLPRFLGFIDANDHAAISIYNPDHALQHGTIVPGT
FSDLTQMSSYDSHARDMIDSAKDASHGQLREGQLSMTEWLSYDRPMTISGLEGKGPWAGD
PDPALNGAKPLDDFQSGIRASHDDAAAGGRSYNTVIGHSYGTTEVGAAATHGNHLDADAV
VLLASPGAFADSAHGLSLQDGAKVFVGKGSWDPIDVANIGGDIMDAFGLTGSVGLGVSPT
EWADAYQMDGGSGGHSSYWDPDNPAMKNVGRILIGDNSHVTPR
Download sequence
Identical sequences E5XR55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]