SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9P4A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9P4A7
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.37e-52
Family Acetylcholinesterase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9P4A7
Sequence length 146
Comment (tr|E9P4A7|E9P4A7_9DIPT) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} OX=946124 OS=Culex pipiens complex sp. YL-2011. GN=CPIJ013918 OC=Culicidae; Culicinae; Culicini; Culex; Culex.
Sequence
TEPLDCTVQGPGGYQYSKLLNKIIGSEDSLHMNVFTKNLNSKQLLPVMLYIHGGAFMRGS
SGVEMYGPDYLIQKDVVFVSFNYRIGALGFISFDSPELGLPGNAGLKDQNLALRWVVDNV
ANFGGDPKNITLFGESAGGCSVHYHM
Download sequence
Identical sequences E9P4A7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]