SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G8QPK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8QPK5
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000103
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8QPK5
Sequence length 187
Comment (tr|G8QPK5|G8QPK5_DECSP) Putative esterase {ECO:0000313|EMBL:AEV24861.1} KW=Complete proteome; Reference proteome OX=640081 OS=oryzae). GN=Dsui_0447 OC=Rhodocyclaceae; Azospira.
Sequence
MSGILYLHGFRSSPASFKARAVAEAMAARGLQERFFCPALSHEPRQAMVQAEAILAAEGP
LTLVGSSLGGFYATWLAERHGLRAVLVNPAVLAHLSLADYVGPQTNLYSGEEFQFTREHV
AQLQAMEVADLRPERYWLLVEEGDEVLDYRQAVARYRDARQTVLAGGDHSFTRFVDFVPQ
ILEFAGL
Download sequence
Identical sequences G8QPK5
gi|372487137|ref|YP_005026702.1| WP_014235562.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]