SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3BQV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BQV8
Domain Number 1 Region: 7-115
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.45e-20
Family Acetylcholinesterase-like 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BQV8
Sequence length 131
Comment (tr|H3BQV8|H3BQV8_HUMAN) Liver carboxylesterase 1 {ECO:0000313|Ensembl:ENSP00000455959} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CES1 OC=Catarrhini; Hominidae; Homo.
Sequence
KELIPEATEKYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHREGASEEEIRLSKMV
MKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAV
EKPPQTEHIEL
Download sequence
Identical sequences H3BQV8
ENSP00000455959 ENSP00000455959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]