SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9D950 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9D950
Domain Number 1 Region: 18-152
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.1e-26
Family Pancreatic lipase, N-terminal domain 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9D950
Sequence length 163
Comment (tr|Q9D950|Q9D950_MOUSE) Pancreatic lipase {ECO:0000256|RuleBase:RU362046} OX=10090 OS=Mus musculus (Mouse). GN=mCG_10680 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLMLWTFAVLLGAVAGREVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQINTRFLLYTN
ENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRVESVNCIC
VDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQVTDSGLCKIP
Download sequence
Identical sequences Q9D950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]