SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U2I9K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U2I9K4
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.93e-20
Family Acetylcholinesterase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U2I9K4
Sequence length 140
Comment (tr|U2I9K4|U2I9K4_9CORY) Uncharacterized protein {ECO:0000313|EMBL:ERJ47143.1} KW=Complete proteome OX=1381111 OS=Corynebacterium pseudodiphtheriticum 090104. GN=N579_00155 OC=Corynebacterium.
Sequence
MTSQPHVVTPTGMITGAWSNNHTVRRFYSIPYANFLGEFDDAELRTANGDVDASTPAPDA
VALTVAAPADAHDRDDLPVIVFIHGGSFETGSHDDPRHDATANVQAGCVQVNIGYRKKLP
GFARFNNDAPSHYRGVHDCY
Download sequence
Identical sequences U2I9K4
WP_021351811.1.75867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]