SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2ZEX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2ZEX7
Domain Number 1 Region: 14-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.86e-42
Family Acetylcholinesterase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2ZEX7
Sequence length 297
Comment (tr|W2ZEX7|W2ZEX7_PHYPR) N-formylkynurenine formamidase {ECO:0000256|HAMAP-Rule:MF_03014} KW=Complete proteome OX=1317064 OS=Phytophthora parasitica P10297. GN=F442_07836 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLRRTLSVLGAYSWKDVAYVAESPHALQALDIAIPRRIPPRSNLPTCVFVHGGSWQRGDK
NGGLNQDIDEAFVGAGYLGVSVNYRLSPEVQHPEHVKDVAAAVTWLYRNIAKFGGDPNKL
VLVGHSAGAHLVMQILADPQYLTAAGMEQPIDTFVKGAVGISGVYNIVRLANTSFYGTLV
TNPPFGERAEQWREASIGMTVTRVGTTSPLTKMPLLLVNAHEDFHFNEDAQELERWLTAA
GNNSIQRHVIPTCNHFTIVEQLANDDLDSNPTMQLIKSFVAEIADPDEISPLKNTFN
Download sequence
Identical sequences V9FB43 W2NGV9 W2ZEX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]