SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1X601 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X1X601
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.42e-39
Family Acetylcholinesterase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X1X601
Sequence length 130
Comment (tr|X1X601|X1X601_ACYPI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:ACYPI080984-PA} KW=Complete proteome; Reference proteome OX=7029 OS=Acyrthosiphon pisum (Pea aphid). GN= OC=Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
Sequence
MQNPSAPVVETRQGALAGFTDDDVHVWSGIPYAAPPVGAWRWRSPQPPAAWEGLRSATMF
SASSWQNSEYCQELGGGDPGQFSEDCLYLNVWSPVARTAPLPVMVWLHGGGFTIGAGGLP
PYNGKALGQA
Download sequence
Identical sequences X1X601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]