SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010931 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010931
Domain Number 1 Region: 601-903
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-83
Family Protein kinases, catalytic subunit 0.0000000000919
Further Details:      
 
Domain Number 2 Region: 8-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-77
Family Ephrin receptor ligand binding domain 0.0000000159
Further Details:      
 
Domain Number 3 Region: 311-516
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-41
Family Fibronectin type III 0.000026
Further Details:      
 
Domain Number 4 Region: 898-972
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.51e-21
Family SAM (sterile alpha motif) domain 0.0000446
Further Details:      
 
Domain Number 5 Region: 240-311,349-368
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000576
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010931   Gene: ENSFALG00000010435   Transcript: ENSFALT00000010975
Sequence length 974
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603230.1:4539493:4648308:1 gene:ENSFALG00000010435 transcript:ENSFALT00000010975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHLPSTETLMDSTTATAELGWTVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWL
RTKYIHRRGAHRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYFESDVDSATKTFPSWMEN
PWMKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVF
YRKCPRVIQNGAVFQETLSGAESTSLVAARGTCIANAEEVDVPIKLYCNGDGEWLVPIGR
CMCRAGYESVENGTVCRGCPSGTFKASQGDEGCVHCPINSRTTSEGATNCVCRNGYYRAD
ADPVDMPCTTIPSAPQAVISSVNETSLMLEWSPPRDLGGREDLVYNIICKSCGAGRGACT
RCGDNVQFAPRQLGLTEPRVYISELLAHTQYTFEIQAVNGVTDQSPFSPHFASVNITTNQ
AAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKDLSELNSTTVKSPTNTV
AVQNLKAGTIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSVQEKLPLIIGSSAAGLV
FLIAVVVIGIVCSRRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREF
AKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEAS
IMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAA
GMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRW
TAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCP
NALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGMNLPLLDRTIPDY
TSFNTVDEWLDAIKMSQYKESFASAGFTTFDVVSQMTVEDILRVGVTLAGHQKKILNSIQ
VMRAQMNQIQSVEV
Download sequence
Identical sequences U3K7C7
ENSFALP00000010931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]