SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000011493 from Ficedula albicollis 76_1.0

(show help)
Strong hits

Sequence:	ENSFALP00000011493
Domain Number 1	Region: 239-301
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	3.5e-19
Family	LIM domain	0.0024
Further Details:

Domain Number 2	Region: 298-360
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	6.25e-16
Family	LIM domain	0.0049
Further Details:

Domain Number 3	Region: 151-178
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000242
Family	LIM domain	0.0078
Further Details:

Weak hits

Sequence:	ENSFALP00000011493
Domain Number -	Region: 355-386
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000136
Family	LIM domain	0.01
Further Details:

Domain Number -	Region: 223-242
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.073
Family	LIM domain	0.026
Further Details:

Domain Number -	Region: 198-224
Classification Level	Classification	E-value
Superfamily	SH3-domain	0.0834
Family	SH3-domain	0.025
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSFALP00000011493 Gene: ENSFALG00000011009 Transcript: ENSFALT00000011539
Sequence length	388
Comment	pep:known_by_projection scaffold:FicAlb_1.4:JH603356.1:223729:226952:1 gene:ENSFALG00000011009 transcript:ENSFALT00000011539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEDLDALLAELEQSSCLASKERALQGPSSCQNAQQGTPKCTVFPQWPVGKGCAGRAGGVL VPADSTASPLCATSSVPVRVPKPLLPSAPRTEAASQLDELLADLGHTQSKLAAAGQGAEV PAESVLDNVLDNMLDSLTRDLQELGITAAPAGVCAACRKPIAGKVLTALGRTWHPEHFTC AQCGRELDKGPFFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPKVLTALEQTWHPEHFFCA HCGKVFGDEGFLERNGKPYCHQDFLAMFAPKCQGCERPVMGNYLSALQGVWHSECFVCTE CLTGFSGGSFFELEGRPYCELHFHQRQGTICHGCGRPVSGRCVTAAGRRYHPEHFVCSYC MRRLHKGTFSECGDKMYCQPCYDKLFLS
Download sequence
Identical sequences	U3K8Y9 ENSFALP00000011493

SEARCH