SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000015193 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000015193
Domain Number 1 Region: 26-252
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.15e-54
Family Ecto-ART 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000015193   Gene: ENSFALG00000014578   Transcript: ENSFALT00000015258
Sequence length 291
Comment pep:novel scaffold:FicAlb_1.4:JH603557.1:86128:87000:-1 gene:ENSFALG00000014578 transcript:ENSFALT00000015258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSMALLALTLALLPMTVATTAYEVKPLDMALDSFDDQYQNCSHAMKAALPALNRFEFQNN
SLFTEVWSQAVSMWRFRGSPVSPLSSSDQATAIMAYTMVFLSEQFNSEVSVAGHSPQEYR
DNFHFKTLHFLLTDALATLWDDQKEEECHCVFWGVDKYKFEANVGDIVRFGQFASSTLCE
DTIHDLRTTTVFKVITCHGVDIREFSRYPSVEEVLIPPFEMFNVTKVMEKGTSVEIHLDS
IGTYSKYNCEWLTGGDSLGPWGHPLGPWGHPLGPWGHPLGPWGHALGPWGH
Download sequence
Identical sequences U3KJI9
ENSFALP00000015193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]