SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1l6nA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l6nA
Domain Number 1 Region: 133-276
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.22e-161
Family Retrovirus capsid protein, N-terminal core domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 21-132
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 5.44e-115
Family Immunodeficiency virus matrix proteins 0.000000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l6nA   PDB: 1l6n
Sequence length 289
Comment (A:)
Sequence
mgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
dtgnnsqvsqnypivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegat
pqdlntmlntvgghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagtt
stlqeqigwmthnppipvgeiykrwiilglnkivrmysptsilhhhhhh
Download sequence
Identical sequences 1l6n_A 1l6nA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]