SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463641 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463641
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.74e-46
Family Acetylcholinesterase-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463641   Gene: ENSG00000172831   Transcript: ENST00000561697
Sequence length 125
Comment pep:putative chromosome:GRCh37:16:66968359:66974437:1 gene:ENSG00000172831 transcript:ENST00000561697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVF
GMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIA
HFGGN
Download sequence
Identical sequences J3QLP1
ENSP00000463641 ENSP00000463641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]