SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014989267.1.3038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014989267.1.3038
Domain Number 1 Region: 198-428
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.54e-73
Family CAT-like 0.0000506
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Single hybrid motif 3.66e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00083
Further Details:      
 
Domain Number 3 Region: 118-162
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000209
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014989267.1.3038
Sequence length 429
Comment branched-chain alpha-keto acid dehydrogenase subunit E2 [Sinorhizobium meliloti]; AA=GCF_000304415.1; RF=na; TAX=1230587; STAX=382; NAME=Sinorhizobium meliloti Rm41; strain=Rm41; AL=Complete Genome; RT=Major
Sequence
MPIEVILPKVDMDMATGKISKWFFKNDATVRKGDVLFEIETDKAAMEIDAPASGVLRDIV
GAEGVDIPVGAPVAWIYEEGEAYGGAPASKEAAAKPIAAIEVTSEKTLAPVEKAVSAADE
GAGIRATPLARRVAREAGIDITTIAGSGPRGRITRLDVENHVVAPSAPPASVAATPSPQA
AERPAPGDHVRKLFAEGSYDELSHSNMRRTIAKRLVEAKTTVPHFYLTLDCKIDALLKLR
AELNGDAAIIDGKPEYKLSVNDMVIKAYAMALRRVPSANVSWTEDGLLQHRHADIGVAVS
VPGGLITPIVRSAEIKTLSAISNEMKDLGARAKEGKLKSDEYQGGTGAVSNLGMFGIREF
AAIVNPPHATILAVGAGERRPIAVRDDVCVATIMTVTLSTDHRAVDGALAAELAGAFRSY
IERPMSMMV
Download sequence
Identical sequences WP_014989267.1.3038 WP_014989267.1.96031 gi|407689812|ref|YP_006813397.1| gi|407689812|ref|YP_006813397.1|NC_018682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]