SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pa_3_6810|chrm3_SC2|Putative from Podospora anserina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pa_3_6810|chrm3_SC2|Putative
Domain Number 1 Region: 13-163
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000014
Family WD40-repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pa_3_6810|chrm3_SC2|Putative
Sequence length 206
Comment protein of unknown function
Sequence
MDTRRRPAKLVPPFRGDVLAVDFLHAQPQVVLAGTRSGHVCQLDTRTAPEAWDSMVFRHK
SSVAHLRAVGGFDVLAAGPKNAMCIYDLRFVKAKEQKAGEKPFEPWERNTAAPAVEFPGY
RNEAHIKIGLDVLTQPGYGHGVVAAAHDDCTVGLYSLRDGSRMPSGDVDKSKAPGVVKAI
QFQTVASDQHPSLFVGVGSVIQKFSY
Download sequence
Identical sequences B2B0P2
XP_001909484.1.27508 Pa_3_6810|chrm3_SC2|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]